PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr021178.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 344aa    MW: 38562.3 Da    PI: 7.2571
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr021178.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.12.3e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv++++++G g+W+t+++  g++R++k+c++rw +yl
      Pbr021178.1 14 KGPWTPEEDHKLVHYIQKHGHGRWRTVPKNAGLKRCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding569.1e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W+tIa++++ gRt++++k++w+++
      Pbr021178.1  67 RGRFSLEEEETIIQLHSVLGNK-WSTIASRLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-26564IPR009057Homeodomain-like
PROSITE profilePS5129419.519961IPR017930Myb domain
SuperFamilySSF466891.12E-3111108IPR009057Homeodomain-like
SMARTSM007171.2E-141363IPR001005SANT/Myb domain
PfamPF002497.2E-181461IPR001005SANT/Myb domain
CDDcd001674.89E-121661No hitNo description
PROSITE profilePS5129425.93162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.7E-2665116IPR009057Homeodomain-like
SMARTSM007176.7E-1666114IPR001005SANT/Myb domain
PfamPF002492.0E-1567111IPR001005SANT/Myb domain
CDDcd001677.44E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MGKIPCCETN GLKKGPWTPE EDHKLVHYIQ KHGHGRWRTV PKNAGLKRCG KSCRLRWANY  60
LRPDIKRGRF SLEEEETIIQ LHSVLGNKWS TIASRLPGRT DNEIKNYWNT HIRKRLLKMG  120
IDPVTHTPRL DLLELTSLLS STLCNSSSDN LQLNIPNLLS IGPITDPELL NLTATLLSSQ  180
RRPQSSYPEF PSKNHAQQNP LSLLQNNDQN QFQSNQLPNI APFLNQPLIT DFGHPCSTNG  240
ADQSSFVPTI TNQVGSYDSN YESIISHNIP GQDYQPACIS DNVNNQTFQN MCSFGSLLST  300
PSSSPATTTY ANCCTEDERD SFCSNILNMY HDIPNDLNVT QLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-31121162105C-Myb DNA-Binding Domain
1msf_C2e-31121162105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009377334.10.0PREDICTED: protein ODORANT1-like
RefseqXP_009377339.10.0PREDICTED: protein ODORANT1-like
TrEMBLM5WK281e-149M5WK28_PRUPE; Uncharacterized protein
STRINGVIT_19s0014g03820.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G05100.13e-83myb domain protein 74